General Information

  • ID:  hor002649
  • Uniprot ID:  O17264
  • Protein name:  NLP-20
  • Gene name:  nas-27
  • Organism:  Caenorhabditis elegans
  • Family:  NA
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Caenorhabditis (genus), Peloderinae (subfamily), Rhabditidae (family), Rhabditoidea (superfamily), Rhabditomorpha (infraorder), Rhabditina (suborder), Rhabditida (order), Chromadorea (class), Nematoda (phylum), Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0004222 metalloendopeptidase activity; GO:0008233 peptidase activity; GO:0008237 metallopeptidase activity; GO:0008270 zinc ion binding; GO:0016787 hydrolase activity; GO:0046872 metal ion binding
  • GO BP:  GO:0006508 proteolysis; GO:0018996 molting cycle, collagen and cuticulin-based cuticle
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  FAFA
  • Length:  4(184-187)
  • Propeptide:  MQILPIFFPLLITSLHAIPRGRRAVRNRNEGDINSLVGVGQYLYQGDIAVVKSRARRAVIRQKHKKWKLPMPYSFDRNFPSRSRQRVLEAMQFWSEKTCVTFHENRYVYPHVSIFEGNGCWSFVGKQPSLREQSLSLERSCTDHTFVVAHEIAHTLGFYHEHARGDRDQFISIDYSNVNPNLTFAFAKESEKQLDHQEAAYEYGSVMHYSVDQFAVNTNRPVIYARDQKFAQAMGNRMRATFQDVSRMNVLYNCH
  • Signal peptide:  MQILPIFFPLLITSLHA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Metalloprotease.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-O17264-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002649_AF2.pdbhor002649_ESM.pdb

Physical Information

Mass: 50822 Formula: C24H30N4O5
Absent amino acids: CDEGHIKLMNPQRSTVWY Common amino acids: AF
pI: 6.11 Basic residues: 0
Polar residues: 0 Hydrophobic residues: 4
Hydrophobicity: 230 Boman Index: 958
Half-Life / Aliphatic Index: 1.1 hour Aliphatic Index: 50
Instability Index: 750 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  17564681
  • Title:  Impaired processing of FLP and NLP peptides in carboxypeptidase E (EGL-21)-deficient Caenorhabditis elegans as analyzed by mass spectrometry.